PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00156g00915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 475aa    MW: 52136.1 Da    PI: 6.3303
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00156g00915.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.48e-34251305155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               kpr+rWtpeLHe Fveav++LGGsekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  Peaxi162Scf00156g00915.1 251 KPRMRWTPELHEVFVEAVHKLGGSEKATPKGVLKLMNVEGLTIYHVKSHLQKYRT 305
                               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.627248308IPR017930Myb domain
SuperFamilySSF466892.51E-18249305IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-31250307IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-25251305IPR006447Myb domain, plants
PfamPF002491.3E-10253304IPR001005SANT/Myb domain
PfamPF143797.4E-23336381IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MNMRRALCIQ RSSEAQHSNM GVSGAMSTSL SILPSLEEKY PKLPDSLHVV TEKERTSNLI  60
SSQAIPSASK SGTVGHLLSS TSGPHKDFHF SPTSSQESRP CNYPFISIEA SAATSQSPLS  120
SIHSTSLDNY PNNNSWGKNA YHDFIDFPPN DPVQNIQAES LAAKASNDLV KQSDWQEWAD  180
QLINDDDDAL GSSWIEHLVD VNLPDPDTKL LRASEVLACQ PQRLHPPPPP AASPGQSCAV  240
GSPSSTTALT KPRMRWTPEL HEVFVEAVHK LGGSEKATPK GVLKLMNVEG LTIYHVKSHL  300
QKYRTARYKP EPSEGTPETK PASVSEMPSL DLKTTMGITE ALKLQMEVQK QLHEQLEIQR  360
KLQLRIEEQG KYLEMMFEKT KDMGKEIKAS SSKSDEHPSP STETKHSLPN DKSEAVEQDL  420
IGPNGASSSG GEFLHGKNKE RNLGERQTCE DHVSDGRDSC SPPSKRSKTQ ETSAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591732.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLM1C5M10.0M1C5M1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000603240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.27e-86G2-like family protein